HPA005576

ZNF490 antibody from Sigma-Aldrich
KIAA1198
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005576
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005576, RRID:AB_10602689
Product name
Anti-ZNF490 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005576
Antibody type
Polyclonal
Antigen
zinc finger protein 490 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NSSLSFQMERPLEEQVQSKWSSSQGRTGTGGSDVL
QMQNSEHHGQSIKTQTDSISLEDVAVNFTLEEWAL
LDPGQRNIYRDVMRATFKNLACIGEKWKDQDIEDE
HKNQGRNLRSPMVEALCENKEDCP
Storage
-20C
Provider Type Product Number
- No reagents -