Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501901 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein 791 (ZNF791) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZNF791 antibody: synthetic peptide directed towards the middle region of human ZNF791
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
CKECGKAFSLHSSFQRHTRIHNYEKPLECKQCGKA
FSVST SLKKHMRMHN- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
Alcohol dehydrogenase 2 variant is associated with cerebral infarction and lacunae.
Suzuki Y, Yamashita R, Shirota M, Sakakibara Y, Chiba J, Mizushima-Sugano J, Nakai K, Sugano S
Genome research 2004 Sep;14(9):1711-8
Genome research 2004 Sep;14(9):1711-8
Alcohol dehydrogenase 2 variant is associated with cerebral infarction and lacunae.
Suzuki Y, Fujisawa M, Ando F, Niino N, Ohsawa I, Shimokata H, Ohta S
Neurology 2004 Nov 9;63(9):1711-3
Neurology 2004 Nov 9;63(9):1711-3
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Western Blotting