Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00011216-M04 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00011216-M04, RRID:AB_534772
- Product name
- AKAP10 monoclonal antibody (M04), clone 8C10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant AKAP10.
- Antigen sequence
MRGAGPSPRQSPRTLRPDPGPAMSFFRRKVKGKEQ
EKTSDVKSIKASISVHSPQKSTKNHALLEAAGPSH
VAINAISANMDSFSSSRTATLKKQPSHMEA- Isotype
- IgG
- Antibody clone number
- 8C10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references D-AKAP2 interacts with Rab4 and Rab11 through its RGS domains and regulates transferrin receptor recycling.
Eggers CT, Schafer JC, Goldenring JR, Taylor SS
The Journal of biological chemistry 2009 Nov 20;284(47):32869-80
The Journal of biological chemistry 2009 Nov 20;284(47):32869-80
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- AKAP10 monoclonal antibody (M04), clone 8C10. Western Blot analysis of AKAP10 expression in Raw 264.7.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of AKAP10 expression in transfected 293T cell line by AKAP10 monoclonal antibody (M04), clone 8C10.Lane 1: AKAP10 transfected lysate(73.8 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged AKAP10 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to AKAP10 on formalin-fixed paraffin-embedded human testis. [antibody concentration 0.5 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol