Antibody data

Product number
H00006788-M13
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006788-M13, RRID:AB_1137478
Product name
STK3 monoclonal antibody (M13), clone 4F7
Provider product page
Abnova Corporation - H00006788-M13
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant STK3.
Antigen sequence
EEEENSDEDELDSHTMVKTSVESVGTMRATSTMSE
GAQTMIEHNSTMLESDLGTMVINSEDEEEEDGTMK
RNATSPQVQRPSFMDYFDKQDFKNKSHENCNQNMH
EPFPMSKNVFPDNWKV
Isotype
IgG
Antibody clone number
4F7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -