HPA007120

STK3 antibody from Sigma-Aldrich
KRS1, MST2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007120
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007120, RRID:AB_10601664
Product name
Anti-AP003355.2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007120
Antibody type
Polyclonal
Antigen
serine/threonine-protein kinase 3 (EC 2.7.11.1)(STE20-like kinase MST2)(MST-2)(Mammalian STE20-like protein kinase 2)(Serine/threonine-protein kinase Krs-1) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ATSTMSEGAQTMIEHNSTMLESDLGTMVINSEDEE
EEDGTMKRNATSPQVQRPSFMDYFDKQDFKNKSHE
NCNQNMHEPFPMSKNVFPDNWKVPQDGDFDFLKNL
SLEELQMRLKALDPMMEREI
Storage
-20C
Provider Type Product Number
- No reagents -