Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00084292-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00084292-M02, RRID:AB_1137312
- Product name
- MORG1 monoclonal antibody (M02), clone 4E12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant MORG1.
- Antigen sequence
VDGRVRRYDLRMGQLFSDYVGSPITCTCFSRDGQC
TLVSSLDSTLRLLDKDTGELLGEYKGHKNQEYKLD
CCLSERDTHVVSCSEDGKVFFW- Isotype
- IgG
- Antibody clone number
- 4E12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Morg1(+/-) heterozygous mice are protected from experimentally induced focal cerebral ischemia.
Stahr A, Frahm C, Kretz A, Bondeva T, Witte OW, Wolf G
Brain research 2012 Oct 30;1482:22-31
Brain research 2012 Oct 30;1482:22-31
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of MORG1 expression in transfected 293T cell line by MORG1 monoclonal antibody (M02), clone 4E12.Lane 1: MORG1 transfected lysate (Predicted MW: 34.3 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged MORG1 is 1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to MORG1 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol