Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1105206 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-1-Aminocyclopropane-1-Carboxylate Synthase Homolog (Arabidopsis)(non-Functional)-Like (ACCSL) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide directed towards the N terminal of human ACCSL
- Description
- Purified using peptide immunoaffinity column
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
MSHRSDTLPVPSGQRRGRVPRDHSIYTQLLEITLH
LQQAMTEHFVQLTSR- Epitope
- N-Term
- Vial size
- 50 μg
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Human Jurkat; WB Suggested Anti-ACCSL Antibody Titration: 0.2-1 ug/ml. Positive Control: Jurkat cell lysate; ACCSL antibody - N-terminal region (AP43566PU-N) in Human Jurkat cells using Western Blot