Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009517-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009517-A01, RRID:AB_463408
- Product name
- SPTLC2 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant SPTLC2.
- Antigen sequence
LKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREML
KRNIGVVVVGFPATPIIESRARFCLSAAHTKEILD
TALKEIDEVGDLLQLKYSRHRLVPLLDRPFDETTY
EETE- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references ORMDL orosomucoid-like proteins are degraded by free-cholesterol-loading-induced autophagy.
Wang S, Robinet P, Smith JD, Gulshan K
Proceedings of the National Academy of Sciences of the United States of America 2015 Mar 24;112(12):3728-33
Proceedings of the National Academy of Sciences of the United States of America 2015 Mar 24;112(12):3728-33
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- SPTLC2 polyclonal antibody (A01), Lot # 051123JC01. Western Blot analysis of SPTLC2 expression in NIH/3T3. (65kDa,OMIM,http://www.ncbi.nlm.nih.gov/entrez/dispomim.cgi?id=605722)