H00000363-B01P

AQP6 antibody from Abnova Corporation
AQP2L
No application information provided.

Antibody data

Product number
H00000363-B01P
Provider
Abnova Corporation
Product name
AQP6 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00000363-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human AQP6 protein.
Antigen sequence
MDAVEPGGRGWASMLACRLWKAISRALFAEFLATG
LYVFFGVGSVMRWPTALPSVLQIAITFNLVTAMAV
QVTWKASGAHANPAVTLAFLVGSHISLPRAVAYVA
AQLVGATVGAALLYGVMPGDIRETLGINVVRNSVS
TGQAVAVELLLTLQLVLCVFASTDSRQTSGSPATM
IGISVALGHLIGIHFTGCSMNPARSFGPAIIIGKF
TVHWVFWVGPLMGALLASLIYNFVLFPDTKTLAQR
LAILTGTVEVGTGAGAGAEPLKKESQPGSGAVEME
SV
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -