HPA001103

RTCB antibody from Sigma-Aldrich
C22orf28, FAAP, HSPC117
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001103
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001103, RRID:AB_1078351
Product name
Anti-C22orf28 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001103
Antibody type
Polyclonal
Antigen
UPF0027 protein C22orf28 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PDDLDLHVIYDVSHNIAKVEQHVVDGKERTLLVHR
KGSTRAFPPHHPLIAVDYQLTGQPVLIGGTMGTCS
YVLTGTEQGMTETFGTTCHGAGRALSRAKSRRNLD
FQDVLDKLADMGIAIRVASPKLVMEEAPESYKNVT
DVVNTCHDAGISKKAIKLRP
Storage
-20C
Provider Type Product Number
- No reagents -