HPA011645

CD300A antibody from Atlas Antibodies
CMRF-35-H9, CMRF35H, IGSF12, IRC1, IRC2, Irp60
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA011645
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA011645, RRID:AB_1846988
Product name
Anti-CD300A
Provider product page
Atlas Antibodies - HPA011645
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SGDHSELSQNPKQASPREELHYASVVFDSNTNRIA
AQRPREEEPDSDYSVIRK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -