Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502610 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Metaxin 1 (MTX1) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-MTX1 antibody: synthetic peptide directed towards the C terminal of human MTX1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine, Zebrafish
- Host
- Rabbit
- Antigen sequence
CLTLLSQRLGSQKFFFGDAPASLDAFVFSYLALLL
QAKLP SGKLQVHLRG- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The mitochondrial inner membrane protein mitofilin exists as a complex with SAM50, metaxins 1 and 2, coiled-coil-helix coiled-coil-helix domain-containing protein 3 and 6 and DnaJC11.
Xie J, Marusich MF, Souda P, Whitelegge J, Capaldi RA
FEBS letters 2007 Jul 24;581(18):3545-9
FEBS letters 2007 Jul 24;581(18):3545-9
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Host: Rabbit Target Name: MTX1 Sample Tissue: Human Fetal Lung Antibody Dilution: 1.0 μg/mL