HPA011543

MTX1 antibody from Atlas Antibodies
MTX, MTXN
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA011543
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA011543, RRID:AB_1234826
Product name
Anti-MTX1
Provider product page
Atlas Antibodies - HPA011543
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
WIDTKNYVEVTRKWYAEAMPFPLNFFLPGRMQRQY
MERLQLLTGEHRPEDEEELEKELYREARECLTLLS
QRLGSQKFFFGDAPASLDAFVFSYLALLLQAKLPS
G
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -