HPA011545

MINAR1 antibody from Atlas Antibodies
KIAA1024, UBTOR
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA011545
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA011545, RRID:AB_1852361
Product name
Anti-KIAA1024
Provider product page
Atlas Antibodies - HPA011545
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
IQSSCYNSTGSLSQLHKSDCDSSPEHNLTKIANGV
PNSKGDKGNRPENTHHSEEELKTSVCKLVLRIGEI
ERKLESLSGVRDEISQVLGKLNKLDQKMQQPEKVS
VQIDLNSLTSEGPSDDSASPRMFHAHS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -