HPA011545

MINAR1 antibody from Sigma-Aldrich
KIAA1024, UBTOR
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011545
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011545, RRID:AB_1852361
Product name
Anti-KIAA1024 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011545
Antibody type
Polyclonal
Antigen
UPF0258 protein KIAA1024 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IQSSCYNSTGSLSQLHKSDCDSSPEHNLTKIANGV
PNSKGDKGNRPENTHHSEEELKTSVCKLVLRIGEI
ERKLESLSGVRDEISQVLGKLNKLDQKMQQPEKVS
VQIDLNSLTSEGPSDDSASPRMFHAHS
Storage
-20C
Provider Type Product Number
- No reagents -