PAB20523

ZMYM6 antibody from Abnova Corporation
Buster2, MYM, ZBED7, ZNF198L4, ZNF258

Antibody data

Product number
PAB20523
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20523, RRID:AB_10984672
Product name
ZMYM6 polyclonal antibody
Provider product page
Abnova Corporation - PAB20523
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant ZMYM6.
Antigen sequence
EPLDGECGKAVVPQQELLDKIKEEPDNAQEYGCVQ
QPKTQESKLKIGGVSSVNERPIAQQLNPGFQLSFA
SSGPSVLLPSVPAVAIKVFCSGCKKMLYKGQTAYH
KTGSTQLFCSTRCITRHSSPACLPPPPKKTCTNCS
KYK
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.