HPA011004

ZMYM6 antibody from Atlas Antibodies
Buster2, MYM, ZBED7, ZNF198L4, ZNF258
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA011004
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA011004, RRID:AB_1236202
Product name
Anti-ZMYM6
Provider product page
Atlas Antibodies - HPA011004
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EPLDGECGKAVVPQQELLDKIKEEPDNAQEYGCVQ
QPKTQESKLKIGGVSSVNERPIAQQLNPGFQLSFA
SSGPSVLLPSVPAVAIKVFCSGCKKMLYKGQTAYH
KTGSTQLFCSTRCITRHSSPACLPPPPKKTCTNCS
KYK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -