HPA011004

ZMYM6 antibody from Sigma-Aldrich
Buster2, MYM, ZBED7, ZNF198L4, ZNF258
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011004
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011004, RRID:AB_1859075
Product name
Anti-ZMYM6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011004
Antibody type
Polyclonal
Antigen
Zinc finger MYM-type protein 6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EPLDGECGKAVVPQQELLDKIKEEPDNAQEYGCVQ
QPKTQESKLKIGGVSSVNERPIAQQLNPGFQLSFA
SSGPSVLLPSVPAVAIKVFCSGCKKMLYKGQTAYH
KTGSTQLFCSTRCITRHSSPACLPPPPKKTCTNCS
KYK
Storage
-20C
Provider Type Product Number
- No reagents -