HPA011006

SYT12 antibody from MilliporeSigma / Merck KGaA
SRG1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011006
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA011006, RRID:AB_2286996
Product name
Anti-SYT12 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA011006
Antibody type
Polyclonal
Antigen
Synaptotagmin-12 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLSLSYLPTAERLTVVVVKAKNLIWTNDKTTADPF
VKVYLLQDGRKMSKKKTAVKRDDPNPVFNEAMIFS
VPAIVLQDLSLRVTVAESSSDGRGDNVGHVIIGPS
ASGMGTTHWNQMLATLRRPVSMWHAV
Storage
-20C
Provider Type Product Number
- No reagents -