Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006124-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006124-M01, RRID:AB_535012
- Product name
- RPL4 monoclonal antibody (M01), clone 4A3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RPL4.
- Antigen sequence
IWTESAFRKLDELYGTWRKAASLKSNYNLPMHKMI
NTDLSRILKSPEIQRALRAPRKKIHRRVLKKNPLK
NLRIMLKLNPYAKTMRRNTILRQARNHKLR- Isotype
- IgG
- Antibody clone number
- 4A3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Transmembrane and coiled-coil domain family 1 is a novel protein of the endoplasmic reticulum.
Shwachman-Bodian Diamond syndrome is a multi-functional protein implicated in cellular stress responses.
Zhang C, Kho YS, Wang Z, Chiang YT, Ng GK, Shaw PC, Wang Y, Qi RZ
PloS one 2014;9(1):e85206
PloS one 2014;9(1):e85206
Shwachman-Bodian Diamond syndrome is a multi-functional protein implicated in cellular stress responses.
Ball HL, Zhang B, Riches JJ, Gandhi R, Li J, Rommens JM, Myers JS
Human molecular genetics 2009 Oct 1;18(19):3684-95
Human molecular genetics 2009 Oct 1;18(19):3684-95
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- RPL4 monoclonal antibody (M01), clone 4A3 Western Blot analysis of RPL4 expression in K-562 ( Cat # L009V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- RPL4 monoclonal antibody (M01), clone 4A3. Western Blot analysis of RPL4 expression in Raw 264.7 ( Cat # L024V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged RPL4 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to RPL4 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol