H00079002-B01

TRIR antibody from Abnova Corporation
C19orf43, fSAP18, MGC2803, TERCIR

Antibody data

Product number
H00079002-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00079002-B01, RRID:AB_1577247
Product name
MGC2803 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00079002-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human MGC2803 protein.
Antigen sequence
MAARGRRAEPQGREAPGPAGGGGGGSRWAESGSGT
SPESGDEEVSGAGSSPVSGGVNLFANDGSFLELFK
RKMEEEQRQRQEEPPPGPQRPDQSAAAAGPGDPKR
KGGPGSTLSFVGKRRGGNKLALKTGIVAKKQKTED
EVLTSKGDAWAKYMAEVKKYKAHQCGDDDKTRPLV
K
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -