HPA011555

antibody from Atlas Antibodies

Targeting: GOLGB1 GCP, GCP372, giantin, GOLIM1

Antibody data

Submit

Validation data

Product number: HPA011555 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA011555, RRID:AB_1079010
Product name: Anti-GOLGB1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: RLSGLANVVLHELSGDDDTDQNMRAPLDPELHQES DMEFNNTTQEDVQERLAYAEQLVVELKDIIRQKDV QLQQKDEALQEERKAADNKIKKLKLHAKAKLTSLN KYIEEMKAQGGTVLPTEPQSEEQLSKHD
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

GOLGB1 protein structure - HPA011555 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, colon, epididymis and kidney using Anti-GOLGB1 antibody HPA011555 (A) shows similar protein distribution across tissues to independent antibody HPA011008 (B).
Antibody #2 product nr: HPA011008
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human epididymis shows strong cytoplasmic positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-GOLGB1 antibody HPA011555.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human epididymis using Anti-GOLGB1 antibody HPA011555.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-GOLGB1 antibody HPA011555.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-GOLGB1 antibody HPA011555.
Sample type: HUMAN