HPA011555

GOLGB1 antibody from Sigma-Aldrich
GCP, GCP372, giantin, GOLIM1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011555
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011555, RRID:AB_1079010
Product name
Anti-GOLGB1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011555
Antibody type
Polyclonal
Antigen
Golgin subfamily B member 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RLSGLANVVLHELSGDDDTDQNMRAPLDPELHQES
DMEFNNTTQEDVQERLAYAEQLVVELKDIIRQKDV
QLQQKDEALQEERKAADNKIKKLKLHAKAKLTSLN
KYIEEMKAQGGTVLPTEPQSEEQLSKHD
Storage
-20C
Provider Type Product Number
- No reagents -