Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA044620 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA044620, RRID:AB_10796803
- Product name
- Anti-GPD1
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
PNVVAVPDVVQAAEDADILIFVVPHQFIGKICDQL
KGHLKANATGISLIK- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Lipid sensing by mTOR complexes via de novo synthesis of phosphatidic acid.
A compound heterozygous mutation in GPD1 causes hepatomegaly, steatohepatitis, and hypertriglyceridemia
Menon D, Salloum D, Bernfeld E, Gorodetsky E, Akselrod A, Frias MA, Sudderth J, Chen PH, DeBerardinis R, Foster DA
The Journal of biological chemistry 2017 Apr 14;292(15):6303-6311
The Journal of biological chemistry 2017 Apr 14;292(15):6303-6311
A compound heterozygous mutation in GPD1 causes hepatomegaly, steatohepatitis, and hypertriglyceridemia
Joshi M, Eagan J, Desai N, Newton S, Towne M, Marinakis N, Esteves K, De Ferranti S, Bennett M, McIntyre A, Beggs A, Berry G, Agrawal P
European Journal of Human Genetics 2014;22(10):1229-1232
European Journal of Human Genetics 2014;22(10):1229-1232
No comments: Submit comment
No validations: Submit validation data