HPA011559

HEG1 antibody from Sigma-Aldrich
HEG, KIAA1237
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011559
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011559, RRID:AB_1850580
Product name
Anti-HEG1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011559
Antibody type
Polyclonal
Antigen
Protein HEG homolog 1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NQEDFSTVSSKEGVMVQTSGKSHAASDAPENLTLL
AETADARGRSGSSSRTNFTILPVGYSLEIATALTS
QSGNLASESLHLPSSSSEFDERIAAFQTKSGTASE
MGTERAMGLSEEWTV
Storage
-20C
Provider Type Product Number
- No reagents -