Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406007 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Polymerase (RNA) II (DNA Directed) Polypeptide K, 7.0kDa (POLR2K) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-POLR2K antibody: synthetic peptide directed towards the middle region of human POLR2K
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
DTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRC
RECGY RIMYKKRTKR- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The NS5A protein of hepatitis C virus represses gene expression of hRPB10alpha, a common subunit of host RNA polymerases, through interferon regulatory factor-1 binding site.
Jung CR, Choi S, Im DS
Virus research 2007 Nov;129(2):155-65
Virus research 2007 Nov;129(2):155-65
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting