Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00126792-M06 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00126792-M06, RRID:AB_605969
- Product name
- B3GALT6 monoclonal antibody (M06), clone 3E5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant B3GALT6.
- Antigen sequence
RLSRDYLRAWHSEDVSLGAWLAPVDVQREHDPRFD
TEYRSRGCSNQYLVTHKQSLEDMLEKHATLAREGR
LCKREVQLRLSYVYDWSAPPSQCCQRREGIP- Isotype
- IgG
- Antibody clone number
- 3E5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Impairment of glycosaminoglycan synthesis in mucopolysaccharidosis type IIIA cells by using siRNA: a potential therapeutic approach for Sanfilippo disease.
Dziedzic D, Wegrzyn G, Jakóbkiewicz-Banecka J
European journal of human genetics : EJHG 2010 Feb;18(2):200-5
European journal of human genetics : EJHG 2010 Feb;18(2):200-5
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of B3GALT6 expression in transfected 293T cell line by B3GALT6 monoclonal antibody (M06), clone 3E5.Lane 1: B3GALT6 transfected lysate (Predicted MW: 36.19 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged B3GALT6 is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol