H00124857-B01

WFIKKN2 antibody from Abnova Corporation
WFDC20B, WFIKKNRP

Antibody data

Product number
H00124857-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00124857-B01, RRID:AB_1205174
Product name
WFIKKN2 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00124857-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human WFIKKN2 protein.
Antigen sequence
MWAPRCRRFWSRWEQVAALLLLLLLLGVPPRSLAL
PPIRYSHAGICPNDMNPNLWVDAQSTCRRECETDQ
ECETYEKCCPNVCGTKSCVAARYMDVKGKKGPVGM
PKEATCDHFMCLQQGSECDIWDGQPVCKCKDRCEK
EPSFTCASDGLTYYNRCYMDAEACSKGITLAVVTC
RYHFTWPNTSPPPPETTMHPTTASPETPELDMAAP
ALLNNPVHQSVTMGETVSFLCDVVGRPRPEITWEK
QLEDRENVVMRPNHVRGNVVVTNIAQLVIYNAQLQ
DAGIYTCTARNVAGVLRADFPLSVVRGHQAAATSE
SSPNGTAFPAAECLKPPDSEDCGEEQTRWHFDAQA
NNCLTFTFGHCHRNLNHFETYEACMLACMSGPLAA
CSLPALQGPCKAYAPRWAYNSQTGQCQSFVYGGCE
GNGNNFESREACEESCPFPRGNQRCRACKPRQKLV
TSFCRSDFVILGRVSELTEEPDSGRALVTVDEVLK
DEKMGLKFLGQEPLEVTLLHVDWACPCPNVTVSEM
PLIIMGEVDGGMAMLRPDSFVGASSARRVRKLREV
MHKKTCDVLKEFLGLH
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -