HPA010953

WFIKKN2 antibody from Sigma-Aldrich
WFDC20B, WFIKKNRP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010953
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010953, RRID:AB_1858828
Product name
Anti-WFIKKN2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010953
Antibody type
Polyclonal
Antigen
WAP, kazal, immunoglobulin, kunitz and NTR domain-containing protein 2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GNGNNFESREACEESCPFPRGNQRCRACKPRQKLV
TSFCRSDFVILGRVSELTEEPDSGRALVTVDEVLK
DEKMGLKFLGQEPLEVTLLHVDWACPCPNVTVSEM
PLIIMGEVDGGMAMLRPDSFVGASSARRVRKLREV
MHKKTC
Storage
-20C
Provider Type Product Number
- No reagents -