H00030834-M01
antibody from Abnova Corporation
Targeting: POLR1H
A12.2, HTEX-6, hZR14, RPA12, tctex-6, ZNRD1
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00030834-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00030834-M01, RRID:AB_566283
- Product name
- ZNRD1 monoclonal antibody (M01), clone 6C12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ZNRD1.
- Antigen sequence
GSVLPLPGAQDTVTCIRCGFNINVRDFEGKVVKTS
VVFHQLGTAMPMSVEEGPECQGPVVDRRCPRCGHE
GMAYHTRQMRSADEGQTVFYTCTNCKFQEKEDS- Isotype
- IgG
- Antibody clone number
- 6C12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of ZNRD1 expression in transfected 293T cell line by ZNRD1 monoclonal antibody (M01), clone 6C12.Lane 1: ZNRD1 transfected lysate(13.9 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged ZNRD1 is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol