Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009804-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009804-M01, RRID:AB_519121
- Product name
- TOMM20 monoclonal antibody (M01), clone 4F3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant TOMM20.
- Antigen sequence
MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFK
NRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFF
LEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQ
LLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLA
EDDVE- Isotype
- IgG
- Antibody clone number
- 4F3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Short RNA molecules with high binding affinity to the KH motif of A-kinase anchoring protein 1 (AKAP1): implications for the regulation of steroidogenesis.
Cellular distribution and subcellular localization of spatacsin and spastizin, two proteins involved in hereditary spastic paraplegia.
Grozdanov PN, Stocco DM
Molecular endocrinology (Baltimore, Md.) 2012 Dec;26(12):2104-17
Molecular endocrinology (Baltimore, Md.) 2012 Dec;26(12):2104-17
Cellular distribution and subcellular localization of spatacsin and spastizin, two proteins involved in hereditary spastic paraplegia.
Murmu RP, Martin E, Rastetter A, Esteves T, Muriel MP, El Hachimi KH, Denora PS, Dauphin A, Fernandez JC, Duyckaerts C, Brice A, Darios F, Stevanin G
Molecular and cellular neurosciences 2011 Jul;47(3):191-202
Molecular and cellular neurosciences 2011 Jul;47(3):191-202
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of TOMM20 expression in transfected 293T cell line by TOMM20 monoclonal antibody (M01), clone 4F3.Lane 1: TOMM20 transfected lysate(16.3 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- TOMM20 monoclonal antibody (M01), clone 4F3. Western Blot analysis of TOMM20 expression in PC-12 ( Cat # L012V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged TOMM20 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to TOMM20 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to TOMM20 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol