HPA011562

TOMM20 antibody from Sigma-Aldrich
KIAA0016, MAS20, MOM19, TOM20
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011562
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011562, RRID:AB_1080326
Product name
Anti-TOMM20 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011562
Antibody type
Polyclonal
Antigen
Mitochondrial import receptor subunit TOM20 homolog recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLK
DAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNA
IAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQ
RIVSAQSLAEDDV
Storage
-20C
Provider Type Product Number
- No reagents -