HPA010866

BAMBI antibody from Sigma-Aldrich
NMA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010866
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010866, RRID:AB_10601686
Product name
Anti-BAMBI antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010866
Antibody type
Polyclonal
Antigen
BMP and activin membrane-bound inhibitor homolog (Xenopus laevis) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NKRLQDQRQQMLSRLHYSFHGHHSKKGQVAKLDLE
CMVPVSGHENCCLTCDKMRQADLSNDKILSLVHWG
MYSGHGKLEFV
Storage
-20C
Provider Type Product Number
- No reagents -