Antibody data

Product number
H00051451-M15
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00051451-M15, RRID:AB_1237763
Product name
LCMT1 monoclonal antibody (M15), clone 3D3
Provider product page
Abnova Corporation - H00051451-M15
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant LCMT1.
Antigen sequence
MATRQRESSITSCCSTSSCDADDEGVRGTCEDASL
CKRFAVSIGYWHDPYIQHFVRLSKERKAPEINRGY
FARVHGVSQLIKAFLRKTECHCQIVNLGAGMDTTF
WRLKDEDLLPSKYFEVDFPMIVTRKLHSIKCKPPL
SSPILELHSEDTLQMDGHILDSKRYAVIGADLRDL
SELEEKLKKCNMNTQLPTLLIAECVLVYMTPEQSA
NLLKWAANSFERAMFINYEQVNMGDRFGQIMIENL
RRRQCDLAGVETCKSLESQKERLLSNGWETASAVD
MMELYNRLPRAEVSRIESLEFLDEMELLEQLMRHY
CLCWATKGGNELGLKEITY
Isotype
IgG
Antibody clone number
3D3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -