Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003965-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003965-A01, RRID:AB_462419
- Product name
- LGALS9 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant LGALS9.
- Antigen sequence
FHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWG
SEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDG
QHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Structural features of galectin-9 and galectin-1 that determine distinct T cell death pathways.
Gene and protein expression of galectin-3 and galectin-9 in experimental pneumococcal meningitis.
Bi S, Earl LA, Jacobs L, Baum LG
The Journal of biological chemistry 2008 May 2;283(18):12248-58
The Journal of biological chemistry 2008 May 2;283(18):12248-58
Gene and protein expression of galectin-3 and galectin-9 in experimental pneumococcal meningitis.
Bellac CL, Coimbra RS, Simon F, Imboden H, Leib SL
Neurobiology of disease 2007 Nov;28(2):175-83
Neurobiology of disease 2007 Nov;28(2):175-83
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- LGALS9 polyclonal antibody (A01), Lot # 050928JC01 Western Blot analysis of LGALS9 expression in Jurkat ( Cat # L017V1 ).