HPA000614

CDC45 antibody from Atlas Antibodies
CDC45L, CDC45L2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000614
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000614, RRID:AB_1078487
Product name
Anti-CDC45
Provider product page
Atlas Antibodies - HPA000614
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MFVSDFRKEFYEVVQSQRVLLFVASDVDALCACKI
LQALFQCDHVQYTLVPVSGWQELETAFLEHKEQFH
YFILINCGANVDLLDILQPDEDTIFFVCDTHRPVN
VVNVYNDTQIKLLIKQDDDLEVPAYEDIFRDEEED
EEHSGNDSDGSEPSEKRTRL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -