HPA000614

CDC45 antibody from Sigma-Aldrich
CDC45L, CDC45L2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000614
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000614, RRID:AB_1078487
Product name
Anti-CDC45L antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000614
Antibody type
Polyclonal
Antigen
CDC45-related protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MFVSDFRKEFYEVVQSQRVLLFVASDVDALCACKI
LQALFQCDHVQYTLVPVSGWQELETAFLEHKEQFH
YFILINCGANVDLLDILQPDEDTIFFVCDTHRPVN
VVNVYNDTQIKLLIKQDDDLEVPAYEDIFRDEEED
EEHSGNDSDGSEPSEKRTRL
Storage
-20C
Provider Type Product Number
- No reagents -