HPA016668

GP2 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016668
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016668, RRID:AB_1849907
Product name
Anti-GP2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016668
Antibody type
Polyclonal
Antigen
Pancreatic secretory granule membrane major glycoprotein GP2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NPIEASSYGLDLDCGAPGTPEAHVCFDPCQNYTLL
DEPFRSTENSAGSQGCDKNMSGWYRFVGEGGVRMS
ETCVQVHRCQTDAPMWLNGTHPALGDGITNHTACA
HWSGNCCFWKTEVLVKACPGGYHVYRLEGTPWCNL
RYCT
Storage
-20C
Provider Type Product Number
- No reagents -