Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00093627-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00093627-M01, RRID:AB_530129
- Product name
- MGC16169 monoclonal antibody (M01), clone 7A7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant MGC16169.
- Antigen sequence
QQLRDRLLANGFNECILLFSDLPEIDIERCVRESI
NLFCWTPKSATYRQHAQPPKPSSDSSGGRSSAPYF
SAECPDPPKTDLSRESIPLNDLKSEVSPRI- Isotype
- IgG
- Antibody clone number
- 7A7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- MGC16169 monoclonal antibody (M01), clone 7A7 Western Blot analysis of MGC16169 expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of MGC16169 expression in transfected 293T cell line by MGC16169 monoclonal antibody (M01), clone 7A7.Lane 1: MGC16169 transfected lysate(93.7 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged MGC16169 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to MGC16169 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
