H00197021-B01

LCTL antibody from Abnova Corporation
FLJ33279, KLG, KLPH

Antibody data

Product number
H00197021-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00197021-B01, RRID:AB_1576711
Product name
LCTL MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00197021-B01
Antibody type
Polyclonal
Antigen
LCTL (AAI52991.1, 1 a.a. ~ 567 a.a) full-length human protein.
Description
Mouse polyclonal antibody raised against a full-length human LCTL protein.
Reactivity
Human
Host
Mouse
Antigen sequence
MKPVWVATLLWMLLLVPRLGAARKGSPEEASFYYG
TFPLGFSWGVGSSAYQTEGAWDQDGKGPSIWDVFT
HSGKGKVLGNETADVACDGYYKVQEDIILLRELHV
NHYRFSLSWPRLLPTGIRAEQVNKKGIEFYSDLID
ALLSSNITPIVTLHHWDLPQLLQVKYGGWQNVSMA
NYFRDYANLCFEAFGDRVKHWITFSDPRAMAEKGY
ETGHHAPGLKLRGTGLYKAAHHIIKAHAKAWHSYN
TTWRSKQQGLVGISLNCDWGEPVDISNPKDLEAAE
RYLQFCLGWFANPIYAGDYPQVMKDYIGRKSAEQG
LEMSRLPVFSLQEKSYIKGTSDFLGLGHFTTRYIT
ERNYPSRQGPSYQNDRDLIELVDPNWPDLGSKWLY
SVPWGFRRLLNFAQTQYGDPPIYVMENGASQKFHC
TQLCDEWRIQYLKGYINEMLKAIKDGANIKGYTSW
SLLDKFEWEKGYSDRYGFYYVEFNDRNKPRYPKAS
VQYYKKIIIANGFPNPREVESWYLKALETCSINNQ
MLAAEPLLSHMQMVTEIVVPTVCSLCVLITAVLLM
LLLRRQS
Vial size
50 μL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -