HPA027268

TSEN2 antibody from Sigma-Aldrich
MGC2776, SEN2, SEN2L
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027268
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027268, RRID:AB_10601347
Product name
Anti-TSEN2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027268
Antibody type
Polyclonal
Antigen
tRNA splicing endonuclease 2 homolog (S. cerevisiae) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GCHPTTESFEKSVREDASPLPHVCCCKQDALILQR
GLHHEDGSQHIGLLHPGDRGPDHEYVLVEEAECAM
SEREAAPNEELVQRNRLICRR
Storage
-20C
Provider Type Product Number
- No reagents -