H00009409-M01A

PEX16 antibody from Abnova Corporation
No application information provided.

Antibody data

Product number
H00009409-M01A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009409-M01A, RRID:AB_1578625
Product name
PEX16 monoclonal antibody (M01A), clone 3E10
Provider product page
Abnova Corporation - H00009409-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant PEX16.
Antigen sequence
MEKLRLLGLRYQEYVTRHPAATAQLETAVRGFSYL
LAGRFADSHELSELVYSASNLLVLLNDGILRKELR
KKLPVSLSQQKLLTWLSVLECVEVFMEMGAAKVWG
ELGRWLVIALIQLAKAVLRILLLLWFKAGLQTSPP
IAPLDRETQAQPPDGDHSPGNHEQSYVGKRSNRVV
RTLQNTPSLHSRHWGAPQQREGRQQQHHEELSATP
TPLGLQETIAEFLYIARPLLHLLSLGLWGQRSWKP
WLLAGVVDVTSLSLLSDRKGLTRRERRELRRRTIL
LLYYLLRSPFYDRFSEARILFLLQLLADHVPGVGL
VTTSQRAASPCLPARPHTQPWSPPAFLPGHP
Isotype
IgM
Antibody clone number
3E10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -