HPA028181

MAST1 antibody from Sigma-Aldrich
KIAA0973, SAST
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028181
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA028181, RRID:AB_10603872
Product name
Anti-MAST1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA028181
Antibody type
Polyclonal
Antigen
microtubule associated serine/threonine kinase 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TLERDVGCTRHQSVQTEDGTGGMARAVAKAALSPV
QEHETGRRSSSGEAGTPLVPIVVEPARPGAKAVVP
QPLGADSKGLQEPA
Storage
-20C
Provider Type Product Number
- No reagents -