HPA011564

RFNG antibody from Atlas Antibodies
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA011564
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA011564, RRID:AB_1079803
Product name
Anti-RFNG
Provider product page
Atlas Antibodies - HPA011564
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
AGFCLSRGLALKMSPWASLGSFMSTAEQVRLPDDC
TVGYIVEGLLGARLLHSPLFHSHLENLQRLPPDTL
LQQVTLSHGGPENPHNVVNVAGGFSLHQDPTRFKS
IHCLLYPDTDWCPRQKQGA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -