Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004088-M05 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004088-M05, RRID:AB_535035
- Product name
- SMAD3 monoclonal antibody (M05), clone 4D5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SMAD3.
- Antigen sequence
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAV
KSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRS
LDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRA
MELCE- Isotype
- IgG
- Antibody clone number
- 4D5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Dysregulation of the TGFBI gene is involved in the oncogenic activity of the nonsense mutation of hepatitis B virus surface gene sW182*.
Activin A regulates porcine follicle-stimulating hormone beta-subunit transcription via cooperative actions of SMADs and FOXL2.
Dual roles of myocardin-related transcription factors in epithelial mesenchymal transition via slug induction and actin remodeling.
Jiang SS, Huang SF, Huang MS, Chen YT, Jhong HJ, Chang IC, Chen YT, Chang JW, Chen WL, Lee WC, Chen MF, Yeh CT, Matsuura I
Biochimica et biophysica acta 2014 Jul;1842(7):1080-7
Biochimica et biophysica acta 2014 Jul;1842(7):1080-7
Activin A regulates porcine follicle-stimulating hormone beta-subunit transcription via cooperative actions of SMADs and FOXL2.
Lamba P, Wang Y, Tran S, Ouspenskaia T, Libasci V, Hébert TE, Miller GJ, Bernard DJ
Endocrinology 2010 Nov;151(11):5456-67
Endocrinology 2010 Nov;151(11):5456-67
Dual roles of myocardin-related transcription factors in epithelial mesenchymal transition via slug induction and actin remodeling.
Morita T, Mayanagi T, Sobue K
The Journal of cell biology 2007 Dec 3;179(5):1027-42
The Journal of cell biology 2007 Dec 3;179(5):1027-42
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- SMAD3 monoclonal antibody (M05), clone 4D5 Western Blot analysis of SMAD3 expression in PC-12 ( Cat # L012V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- SMAD3 monoclonal antibody (M05), clone 4D5. Western Blot analysis of SMAD3 expression in Jurkat ( Cat # L017V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged SMAD3 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol