HPA010957

NRG4 antibody from Atlas Antibodies
HRG4
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA010957
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA010957, RRID:AB_888764
Product name
Anti-NRG4
Provider product page
Atlas Antibodies - HPA010957
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCR
CVENYTGARCEEVFLPGSSIQTK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -