HPA010957

NRG4 antibody from Sigma-Aldrich
HRG4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010957
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010957, RRID:AB_1079504
Product name
Anti-NRG4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010957
Antibody type
Polyclonal
Antigen
Pro-neuregulin-4, membrane-bound isoform recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCR
CVENYTGARCEEVFLPGSSIQTK
Storage
-20C
Provider Type Product Number
- No reagents -