Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009061-M05 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009061-M05, RRID:AB_530161
- Product name
- PAPSS1 monoclonal antibody (M05), clone 1F4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PAPSS1.
- Antigen sequence
QIHEGASLPFFEVFVDAPLHVCEQRDVKGLYKKAR
AGEIKGFTGIDSEYEKPEAPELVLKTDSCDVNDCV
QQVVELLQERDIVPVDASYEVKELYVPENKLHLAK
TDAE- Isotype
- IgG
- Antibody clone number
- 1F4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of PAPSS1 expression in transfected 293T cell line by PAPSS1 monoclonal antibody (M05), clone 1F4.Lane 1: PAPSS1 transfected lysate(68.5 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to PAPSS1 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol