Antibody data

Product number
HPA040174 - Provider product page
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA040174, RRID:AB_10805605
Product name
Anti-AAGAB
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GGASNTTDAQVDSIVDPMLDLDIQELASLTTGGGD
VENFERLFSKLKEMKDKAATLPHEQRKVHAEKVAK
AFWMAIG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
AAGAB protein structure - HPA040174 shown in red.