HPA011630

LINGO1 antibody from Sigma-Aldrich
FLJ14594, LERN1, LRRN6A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011630
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011630, RRID:AB_1853361
Product name
Anti-LINGO1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011630
Antibody type
Polyclonal
Antigen
Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FPDVLLPNYFTCRRARIRDRKAQQVFVDEGHTVQF
VCRADGDPPPAILWLSPRKHLVSAKSNGRLTVFPD
GTLEVRYAQVQDNGTYLCIAANAGGNDSMPAHLHV
RSYSPDWPHQPNKTFAFISNQP
Storage
-20C
Provider Type Product Number
- No reagents -